PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr000315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 375aa    MW: 41593.5 Da    PI: 7.9671
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr000315.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.4e-53151421128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra++sgyWkatg+dk++l++ ++
  Pbr000315.1  15 LPPGFRFHPTDEELVVHYLKKKAASIPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFTPRDRKYPNGARPNRAATSGYWKATGTDKPILTSiGN 111
                  79****************************.89***************8888999**************************************99899 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Pbr000315.1 112 HNVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                  99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6410181IPR003441NAC domain
PROSITE profilePS5100560.98915181IPR003441NAC domain
PfamPF023659.3E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MESTDSSSGS PHPQLPPGFR FHPTDEELVV HYLKKKAASI PLPVTIIAEV DLYKFDPWEL  60
PSKATFGEQE WYFFTPRDRK YPNGARPNRA ATSGYWKATG TDKPILTSIG NHNVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLINNTTTAN MSFSTTKPSD AANKKASLRL DDWVLCRVYK  180
KNNAQRPTMS MEGDHFLHKA EDSNSSMEEG MFLHPSILPT QKPPPFPPPL SSKLPTTNYT  240
ALLESDYHES FFEGILSSSD HQQGSHSHHH DHDHDQFGAI STSSSKTSIP LKRQLSSPFW  300
NDVGSIGSAA AATTTSSSKR FQADLNSENN SFVSLLNQMP QGTAPFYPNP ALLGSLGDEV  360
LRPQFQLPSM NWNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-731518315170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981240.0KF198124.1 Malus hupehensis NAC domain protein (NAC92) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379434.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-109NAC25_ARATH; NAC transcription factor 25
TrEMBLD9ZJA20.0D9ZJA2_MALDO; NAC domain class transcription factor
STRINGPOPTR_0011s04650.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-104NAC domain containing protein 25